WebGFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins. Secuencia Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH Forma física WebGFPT2. General description of the gene and the encoded protein (s) using information from HGNC and Ensembl, as well as predictions made by the Human Protein Atlas project. Official gene symbol, which is typically a short form of the gene name, according to HGNC. Full gene name according to HGNC.

Anti-GFPT2 antibody (GTX66370) GeneTex

WebFor the GFP validation the signal overlap between the antibody staining and the GFP-tagged protein is evaluated. For the independent antibodies validation the evaluation is … WebPrimary Antibodies 15601 Secondary Antibodies 769 Isotype Controls 218 Antibody Duos and Panels 191 Reagents 346 Kits 2168 Mouse IgM Kappa Isotype Control antibody Cat. hogwarts mystery cure for boils

GFPT2 Polyclonal Antibody (PA5-26290) - Thermo Fisher Scientific

WebAntibodies that detect GFPT2 can be used in several scientific applications, including Western Blot, Immunohistochemistry, Immunocytochemistry, Flow Cytometry and … WebRecombinant Anti-GFPT2 antibody [EPR19095] (ab190966) Datasheet SDS Certificate of Compliance Reviews ( 1) Submit a question References (6) $550 Product size 100 µl $550 10 µl Trial Size $230 Add to basket Order now and get it on Monday March 06, 2024 … WebAssigned HPA protein class (es) for the encoded protein (s). Number of protein-coding transcripts from the gene as defined by Ensembl. A summary of the overall protein … hubertushof st.johann im pongau